Cell-Penetrating Peptides


Cell-penetrating peptides are a type of short peptide that can carry macromolecular substances into cells. Their membrane-penetrating ability does not rely on classic endocytosis. Cell-penetrating peptides are all positively charged polypeptide fragments of varying lengths, which are rich in basic amino acid residues such as arginine and lysine. Their secondary structures all have an α-helical spatial conformation. Taking advantage of these characteristics, membrane-penetrating peptides with stronger penetrating power and higher efficiency have been artificially synthesized, and they have successfully carried macromolecular substances into cells to exert biological activities. Therefore, cell-penetrating peptides can promote other biomolecules, such as drugs, proteins or nucleic acids, to cross the cell membrane and enter the interior of the cell. This ability makes cell-penetrating peptides potentially useful in drug delivery and biomedical research. To this end, CD Bioparticles develops and provides the most comprehensive range of cell-penetrating peptide products for related research.

Product Name Catalog Unit Size Price
GRKKRRQRRRPQ CDCCP23-020L 1 mg, 5 mg, 10 mg, 25 mg, 50 mg, 100 mg INQUIRY
YGRKKRRQRRR CDCCP23-024L 1 mg, 5 mg, 10 mg, 50 mg INQUIRY
Tyr-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-NH2 CDCCP23-038L 1 mg, 5 mg, 10 mg, 50 mg, 100 mg INQUIRY
YGRKKRRQRRR-NH2 CDCCP23-111L 50 mg, 100 mg, 250 mg INQUIRY
GRKKRRQRRRPPSPAKLSFQFPSSGSAQVHI CDCCP23-027L 1 mg, 5 mg, 10 mg, 50 mg, 100 mg INQUIRY
Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Pro-Pro-Ser-Pro-Ala-Lys-Leu-Ser-Phe-Gln-Phe-Pro-Ser-Ser-Gly-Ser-Ala-Gln-Val-His-Ile CDCCP23-040L 1 mg, 5 mg, 10 mg INQUIRY
YGRKKRRQRRRYKEGYNVYG CDCCP23-033L 1 mg, 5 mg, 10 mg, 50 mg, 100 mg INQUIRY
Tyr-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Val-Tyr-Lys-Tyr-Gly-Gly-Tyr-Asn-Glu CDCCP23-074L 50 mg, 100 mg, 250 mg INQUIRY
Arg-Arg-Arg-Gln-Arg-Arg-Lys-Lys-Arg-Gly-Gly-Asp-Ile-Met-Gly-Glu-Trp-Gly-Asn-Glu-Ile-Phe-Gly-Ala-Ile-Ala-Gly-Phe-Leu-Gly CDCCP23-006L 1 mg, 5 mg, 10 mg, 50 mg, 100 mg INQUIRY
YGRKKRRQRRRKLSSIESDV CDCCP23-019L 1 mg, 5 mg, 10 mg, 25 mg, 50 mg, 100 mg INQUIRY
YGRKKRRQRRRKLSSIESDV (TFA salt) CDCCP23-011L 1 mg, 5 mg, 10 mg, 25 mg, 50 mg, 100 mg INQUIRY
Tyr-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Gly-Gly-Gly-Leu-Asp-Lys-Glu-Phe-Asn-Ser-Ile-Phe-Arg-Arg-Ala-Phe-Ala-Ser-Arg-Val-Phe-Pro-Pro-Glu CDCCP23-061L 50 mg, 100 mg, 250 mg INQUIRY
Tyr-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Gly-Gly-Gly-Glu-Asn-Ser-Phe-Arg-Phe-Leu-Ala-Asp-Ile-Phe-Pro-Ala-Lys-Ala-Phe-Pro-Val-Arg-Phe-Glu CDCCP23-147L 50 mg, 100 mg, 250 mg INQUIRY
Tyr-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Gly-Gly-Gly-Leu-Leu-Asp-Tyr-Val-Pro-Ile-Gly-Pro-Arg-Phe-Ser-Asn-Leu-Val-Leu-Gln-Ala-Leu-Leu-Val-Leu CDCCP23-078L 50 mg, 100 mg, 250 mg INQUIRY
Tyr-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Gly-Gly-Gly-Ile-Pro-Pro-Val-Tyr-Phe-Ser-Arg-Leu-Asp-Leu-Asn-Leu-Val-Val-Leu-Leu-Leu-Ala-Gln-Leu CDCCP23-131L 50 mg, 100 mg, 250 mg INQUIRY
GGGG CDCCP23-056L 5 mg, 10 mg, 25 mg, 50 mg, 100 mg INQUIRY
GGGG CDCCP23-063L 50 mg, 100 mg, 250 mg INQUIRY
Thr-His-Arg-Pro-Pro-Met-Trp-Ser-Pro-Val-Trp-Pro CDCCP23-090L 50 mg, 100 mg, 250 mg INQUIRY
Thr-His-Arg-Pro-Pro-Met-Trp-Ser-Pro-Val-Trp-Pro CDCCP23-018L 5 mg, 10 mg, 50 mg, 100 mg INQUIRY
Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Lys-Ile-Asn-Leu-Lys-Ala-Leu-Ala-Ala-Leu-Ala-Lys-Lys-Ile-Leu-NH2 CDCCP23-153L 50 mg, 100 mg, 250 mg INQUIRY
Products
Fill out the form below
to receive a quote

GET A QUOTE

  • (USA)
  • (Europe)
Cookie Policy | Privacy Policy | Copyright © 2024 CD Bioparticles. All rights reserved.
0
Inquiry Basket
Inquiry